<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
8 8w12 France 2006 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+NVP+TDF 13

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R   G190A V179D T39E, S48T, K122E, D123G, K173T, Q174K, T200A, Q207E, F214L, L228Q, K238R, V245Q  
>8w12| codons 38-247
CEEMEKEGKITKIGPENPYNTPVFAIKRKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDEGFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRTKNPDIDIYQYMDDLYVASDLEIGQHRAKIEELREHLLRWGLTTP
DKKHQKEPPFQWMGYELHPDRWTVQPIQLP

References
Author Title Citation
Rey, D High rate of early virological failure with the once-daily tenofovir/lamivudine/nevirapine combination in naive HIV-1-infected patients. AAC, 2009