<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+NVP+TDF 13

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R   G190A V179D T39E, S48T, K122E, D123G, K173T, Q174K, T200A, Q207E, F214L, L228Q, K238R, V245Q  
>8w12| codons 38-247
CEEMEKEGKITKIGPENPYNTPVFAIKRKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDEGFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRTKNPDIDIYQYMDDLYVASDLEIGQHRAKIEELREHLLRWGLTTP
DKKHQKEPPFQWMGYELHPDRWTVQPIQLP

References
Author Title Citation
Rey, D High rate of early virological failure with the once-daily tenofovir/lamivudine/nevirapine combination in naive HIV-1-infected patients. AAC, 2009