<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
1 1w12 France 2006 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+NVP+TDF 12

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, M184MI T215C K101E, Y181YC, G190A   K49R, K82KR, K103R, I135K, I180V, Q197K, I202V, R211K, V245T  
>1w12| codons 38-247
CTEMEKEGKISRIGPENPYNTPVFAIKRKDSTKWRKLVDFRELNRRTQDFWEVQLGIPHP
AGLEKRKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSKNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVVCQYIDDLYVASDLEIGKHRTKVEELRQHLLKWGFCTP
DKKHQKEPPFLWMGYELHPDKWTVQPITLP

References
Author Title Citation
Rey, D High rate of early virological failure with the once-daily tenofovir/lamivudine/nevirapine combination in naive HIV-1-infected patients. AAC, 2009