<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6800 CA17091 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 170
2 AZT+DDI 56
3 3TC+AZT 22
4 3TC+AZT+SQV 4
5 3TC+AZT+RTV 65
6 D4T+DDI+NVP 39
7 DDC+RTV+SQV 39
8 3TC+ABC+EFV+RTV+SQV 17
9 APV+D4T+DDI 44
10 3TC+ABC+IDV+RTV 14

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V L33F L10V, K20R, E35N, M36I, N37T, F53I, R57K, I62V, L63P, C67CW, V77I, I85X  
>CA17091| codons 10-99
VVTIKIGGQLREALLDTGADDTVFENITLPGRWKPKMIGGIGGIIKVKQYDQVPIEIWGH
KAIGTVLIGPTPVNVXGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, Q151M, M184MV, T215F A62V, V75IT, K219Q K103N, Y188L   K20R, I31R, T39A, A98S, V118I, K122E, R172K, V179I, I202V, F214L, L228H, V245VE, T286A, A288AG, V292I, I293IL L289LR
>CA16846| codons 1-303
PISPIETVPVKLKPGMDGPRVKQWPLTEEKRKALVEICAELEKEGKISKIGPENPYNTPV
FVIKKKNSDKWRKLIDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAIFQSSMTKILEPFKKQNPDIII
YQYVDDLLVGSDLEIGQHRTKVEELRQHLLRWGLFTPDQKHQKEPPFHWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKGRTEILPLTEEAE
LEL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005