<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6799 CA17090 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 74
2 3TC+D4T+IDV 210

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, V82T, I84IV, L90LM   L10I, E35D, N37ND, R41RK, K45R, L63P, A71AV, I93L, C95F  
>CA17090| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEDMDLPGKWKPRIIGGIGGFIKVRQYD
QIPIEICGHKVIGTVLVGPTPTNVIGRNLMTQLGFTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V V75A     S48T, D121Y, K122E, E169D, D177E, T200A, Q207K, L283I, I293V, P294T K281KE, L289LR, A299AG
>CA16845| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLADFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELRKHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCELIRGTKARTEVVTLTEEGE
LEL

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005