<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA3891 CA17088 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 156
2 DDI 60
3 D4T 26
4 AZT 8
5 3TC+D4T 17
6 3TC+AZT+RTV 13
7 3TC+AZT+IDV 35
8 3TC+D4T+IDV 25
9 D4T+DDC+NFV 52
10 ABC+EFV+RTV 30
11 3TC+ABC+AZT+NFV 66

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90LM Q58E L10I, I15V, K20R, E35D, M36I, N37E, L63P  
>CA17088| codons 1-99
PQITLWQRPIVTIKVGGQLREALLDTGADDTVLEDIELPGRWKPKMIGGIGGFVKVREYD
QIPIEICGHKAIGTVLVGPTPANIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67DN, M184V, L210W, T215Y       V60I, I135T, I142V, V179VG, R211K, V245K, I293V A299AG
>CA16843| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIGI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTEEGE
LEL

References
Author Title Citation
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005