<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6796 CA17086 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 30
2 D4T 70
3 3TC+D4T+DDI+IDV 65
4 D4T+NFV+NVP 28
5 3TC+D4T+IDV 6
6 3TC+AZT+D4T+IDV 18
7 DDI+NFV+SQV 34
8 EFV+RTV+SQV 9
9 3TC+APV+D4T 9
10 3TC+APV+D4T+DDI 20
11 ABC+APV+RTV 9
12 3TC+DDI+IDV 21
13 3TC+D4T+DDI+LPV 12

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, I84V, L90M V11I, G73T L10I, I13V, K20I, M36I, I62V, L63P, A71V  
>CA17086| codons 1-99
PQITLWQRPIITVKIGGQLIEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFVKVRQYD
QVPIEICGHKVITTVLVGPTPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69D, L74LI, M184V, L210W, T215Y K219R K103N A98G T39D, E44D, V118I, K122E, I142V, S162C, V179I, G196E, I202V, R211K, L228H, V245M, A272P, I293V, E297R  
>CA16841| codons 1-302
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICDELEKDGKISKIGPENPYNTPV
FAIKKKDSDKWRKIVDFRELNKRTQDFWEVQLGIPHPGGLKKNKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIII
YQYVDDLYVGSDLEIEQHRTKVEELRQHLWKWGFYTPDRKHQKEPPFHWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTREAE
LE

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005