<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6791 CA17079 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown 52
2 3TC+AZT+IDV 78

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
N88S, L90M L10F I15V, K20T, E35D, M36I, R41K, R57K, I62V, L63P, I64IL, I66IV, A71T, I93L  
>CA17079| codons 1-99
PQITLWQRPFVTIKVGGQLTEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QVPLEVCGHKTIGTVLVGPTPVNIIGRSLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Y115F, Q151M A62V, V75I, F77L, F116Y, T215TS Y181C   E40K, K46Q, K49R, I50V, T58N, S68G, K122E, Q174K, T200A, Q207E, R211K, K219T, V245T, E248D, D250E, S251D, A272P, K277R, T286A, A288S, V292I, E297K M230MV
>CA16833| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTKMEKEGQISRVGPENPYNNPV
FVIKKKDGTKWRKLIDLRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAFYSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAIFQSSMTKILEPFRKKNPDIVI
CQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFSTPDTKHQKEPPFLWVGYELHPDKWT
VQPITLPDKEDWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKSLTEIIPLTKEAE
LEL

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005