<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1539 CA17065 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI+3TC 42
2 D4T+DDI+EFV+NFV 147

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M   L10V, I13V, P39PS, L63P, A71T, V77I, Q92K, I93L  
>CA17065| codons 1-99
PQITLWQRPVVTVKIGGQLKEALLDTGADDTVLEEMNLSGRWKPKIIGGIGGFIKVRQYD
QIPIEICGHKTIGTVLIGPTPVNIIGRNLMTKLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  D67G, K219KR L100I, K103N   P4PS, V35M, T131TP, A158S, V189I, I202IV, K277R, P294T, E297K L289LR, A299AG
>CA16959| codons 1-303
PISSIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICTEMEKEGKISKIGPENPYNTPV
FAIKKKGSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFPIPSINNETPGIRYQYNVLPQGWKGSPSIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYIGSDLEIGQHRTKVEELRQHLLRWGFTTPDRKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKARTEVITLTKEGE
LEL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005