<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6877 CA17058 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+IDV 70
2 D4T+DDI+NFV+NVP 145

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, V82T, I84V   L10IV, L63P, I66IV, V77I, I93L, C95F  
>CA17058| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYD
QIPIEVCGHKAIGTVLIGPTPTNVIGRNLLTQLGFTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103N   K11KR, K20KR, K64KR, E169D, D177N, T200A, R211K, K277R, I293V, E297A  
>CA16950| codons 1-302
PISPIETVPVRLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIRKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPNIVI
YQYVDDLYVGSDLEIGQHRAKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKALTEVVPLTAEAE
LE

References
Author Title Citation
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005