<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6867 CA17044 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 52
2 AZT+ DDC 52
3 3TC+ AZT 26
4 D4T+ 3TC+ RTV 130
5 3TC+ D4T+ RTV+ IDV 78

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54A, V82A, L90M L33F, Q58E L10I, I13V, I62V, L63P, I66F, A71V  
>CA17044| codons 1-99
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVFEEMNLPGRWKPKMIGGIGGFAKVREYD
QVPIEFCGHKVIGTVLVGPTPANIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y       V35M, T39A, R83K, V118I, K122E, D123E, I135V, S162A, Q207E, R211K, V245Q, A272P, K277R, T286A, A288AG K281KE, K287KT, A299AG
>CA16937| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICAELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELREHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCELLRGATGLTEVIPLTEEGE
LEL

References
Author Title Citation
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005