<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6864 CA17040 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown NA
2 3TC+D4T 8
3 3TC+D4T+SQV 43
4 Unknown 143
5 AZT+D4T+EFV+NVP 35

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46ML, G48GV, I54IV, V82A Q58E L10LI, M36I, R41K, I62V, L63P, K70Q, I93L  
>CA17040| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEINLPGKWKPKLIVGIGGFVKVREYD
QVPIEICGHQAIGTVLVGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    G190S   R83K, V90I, K101R, I135T, S162Y, V179VG, D237E, V245E, I293V, L295LR A299AG
>CA16934| codons 1-302
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEIQLGIPHPAGLRKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKQNPDIGI
YQYMDDLYVSSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPEKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPRTEEGE
LE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005