<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
99NG335 99NG335 Nigeria 1999 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  G48E I13V, K14R, K20I, E35Q, M36I, R41K, G51E, R57K, D60N, H69K, V82I, L89M, T91A, I93L R8Q, G52E, C67K
>99NG335| codons 1-99
PQITLWQQPLVTVRIGGQLIEALLDTGADDTVLEQINLPGKWKPKMIEGIEEFIKVKQYN
QILIEIKGKKAIGTVLVGPTPINIIGRNMLAQLGCTLNF

References
Author Title Citation
Zeh, C Nigerian HIV type 2 subtype A and B from heterotypic HIV type 1 and HIV type 2 or monotypic HIV type 2 infections. ARHR, 2005