<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4416 CA17027 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ NFV+ D4T 73
2 ABC+ SQV+ 3TC+ AZT+ RTV 15
3 ABC+ 3TC+ AZT 6
4 IDV+ ABC+ AZT+ 3TC 24
5 Unknown 11

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I G73T L19I, N37T, G51A, L63Q, I64V, A71AV, V77I  
>CA17027| codons 1-99
PQITLWQRPLVTIKIGGQIKEALLDTGADDTVLEEMTLPGRWKPKIIGGIAGFIKVRQYD
QIQVEICGHKVITTVLIGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215FV K219Q Y181YC, G190GA   V35M, V60I, R83K, E169D, Q207E D17DA
>CA16920| codons 1-250
PISPIETVPVKLKPGMAGPKVKQWPLTEEKIKALMEICTEMEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
CQYVDDLYVASDLEIGQHRTKIEELREHLLRWGFFTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKD

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005