<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA3978 CA17025 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 57
2 3TC+AZT 22
3 3TC+AZT+IDV 74
4 DDI+NFV+NVP 61
5 D4T+NVP+SQV 21
6 APV+D4T+NVP+SQV 39
7 3TC+ABC+DDI+LPV 12

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A, L90M G73T L10I, N37D, K55R, L63P, A71V, I93L  
>CA17025| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMDLPGRWKPKIIGGIGGFVRVRQYD
QIPIEICGHKVITTVLVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y V75M K101E, Y181C, G190A   P14PS, E28K, K32E, V35L, T39A, K43E, E44D, V118I, K122E, I135T, G196E, R211K, V245Q, I293V, E297K N54NI
>CA16918| codons 1-303
PISPIETVPVKLKSGMDGPKVKQWPLTKEKIEALLEICAELEEDGKISKIGPEIPYNTPV
FAIKKKNSTKWRKLMDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYMDDLYVASDLEIEQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTKEAE
LEL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005