<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
450487-M 450487-M Uganda 2004 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K20M, M36I, P39S, R41K, I62V, L63P, I64V  
>450487-M| codons 1-99
PQITLWQRPLVTVKIGGQLMEALLDTGADDTVLEEINLSGKWKPKMIGGIGGFIKVRQYD
QVPVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V21I, V35T, T39TA, K49R, V60I, K122E, E138A, E169D, I178M, T200R, Q207N, V245K, A272P, L282C, T286A, I293V, A327V  
>450487-M| codons 1-334
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALTEICAEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNATPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDMVI
YQYMDDLYVGSDLEIGQHRRKIEELRNHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKCLRGAKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIVEIQKQGQ

References
Author Title Citation
Towler, WI Analysis of drug resistance in children receiving antiretroviral therapy for treatment of HIV-1 infection in Uganda. ARHR, 2010