<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
413094-D 413094-D Uganda 2004 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10LI, I13V, L33V, R41K, L63PS, I64V, C67CY  
>413094-D| codons 1-99
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVVEEMNLPGKWKPKMIGGIGGFIKVRQYD
QISVEIYGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, V60I, K122E, D123S, E138A, I142T, K166R, D177E, I178M, Q207E, R211K, V245K, A272P, K277R, L282C, L283I, I293V, K311R T286I
>413094-D| codons 1-334
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNATPGTRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPEMVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKCIRGIKALTEVVPLTEEAE
LELAENREILREPVHGVYYDPSKDLIAEIQKQGQ

References
Author Title Citation
Towler, WI Analysis of drug resistance in children receiving antiretroviral therapy for treatment of HIV-1 infection in Uganda. ARHR, 2010