<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
400541-A 400541-A Uganda 2004 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, G16E, K20R, E35D, M36I, R41K, K43R, H69K, K70R, L89M  
>400541-A| codons 1-99
PQITLWQRPLVTVKIEGQLREALLDTGADDTVLEDINLPGKWRPKMIGGIGGFIKVRQYD
QILIEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, K49R, V60I, K122E, D123N, Y144F, D177E, Q207A, R211K, V245N, D250E, A272S, K277R, L282C, L283I, T286V, I293V  
>400541-A| codons 1-334
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRFQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELRAHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPINLPEKESWTVNDIQKLVGKLNWASQIYSGIKVRQLCKCIRGVKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQ

References
Author Title Citation
Towler, WI Analysis of drug resistance in children receiving antiretroviral therapy for treatment of HIV-1 infection in Uganda. ARHR, 2010