<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
326455-J 326455-J Uganda 2004 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12TA, I13V, E35D, M36I, R41K, K45R, R57K, L63H, H69K, L89M  
>326455-J| codons 1-99
PQITLWQRPLVAVKIGGQLKEALLDTGADDTVLEDINLPGKWKPRMIGGIGGFIKVKQYD
QIHIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, V35T, V60I, K122E, D123S, K173L, Q174K, D177E, V179T, T200I, Q207E, R211S, F214L, V245E, D250E, T286A, E291D, V292VI, I293V, P294T  
>326455-J| codons 1-334
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRLKNPEITI
YQYMDDLYVGSDLEIGQHRIKIEELREHLLSWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKESWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVTLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQ

References
Author Title Citation
Towler, WI Analysis of drug resistance in children receiving antiretroviral therapy for treatment of HIV-1 infection in Uganda. ARHR, 2010