<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
8 338994-E Uganda 2004 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, G17E, R41K, D60DE, L63P, A71AT, I72IV  
>338994-E| codons 1-99
PQITLWQRPVVTIKIGEQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYE
QIPIEICGHKTVGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K11S, V35T, T39K, V60I, K122E, D123S, I135T, D177E, I178M, G196K, T200A, Q207E, V245K, D250E, A272P, T286A, T296S  
>338994-E| codons 1-334
PISPIETVPVSLKPGMDGPKVKQWPLTEEKIKALTEICKEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMVI
YQYMDDLYVGSDLEIKQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVIPLSEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQ

References
Author Title Citation
Towler, WI Analysis of drug resistance in children receiving antiretroviral therapy for treatment of HIV-1 infection in Uganda. ARHR, 2010