<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6835 CA17007 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+D4T 65
2 DDI+EFV+IDV 77

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32VI, M46I, L90M L10F I15V, K20I, M36I, N37S, R57K, L63P, A71V, I72V, I85IV  
>CA17007| codons 10-99
FVTIKVGGQLIEALLDTGADDTILEEISLPGRWKPKIIGGIGGFIKVKQYDQIPIEICGH
KVVGTVLVGPTPVNIVGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, T215F   K103N, Y181C, G190A   V35T, D123E, T139KR, D177E, T240TP, V245VM, A272P K13KN, Q242QE, I244IT, Q269QE
>CA16898| codons 1-274
PISPIETVPVKLNPGMDGPKVKQWPLTEEKIKALTEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNEKPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
CQYMDDLYVASDLEIGQHRTKIEELRQHLLRWGFFTPDKKHQKEPPFLWMGYELHPDKWP
VEPTMLPEKDSWTVNDIQKLVGKLNWASEIYPGI

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009