<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA628 CA17003 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 17
2 AZT+DDC 4
3 AZT+D4T 17
4 3TC+AZT+D4T 17
5 3TC+AZT+SQV 44
6 3TC+D4T+IDV 48
7 D4T+DDI+RTV+SQV 32
8 DDI+RTV+SQV 4
9 None 1
10 DDI+Unknown 29
11 D4T+DDI+Unknown 5
12 D4T+DDI 1
13 None 48
14 ABC+APV+D4T+EFV+RTV 24
15 None 2

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, V82A, I84V, L90M L23I, Q58E L10I, D60E, Q61EK, L63P, A71T, I72T  
>CA17003| codons 1-99
PQITLWQRPIVTIKIGGQLKEAILDTGADDTVLEEMNLPGRWKPKLIGGIGGFIKVREYE
EIPIEICGHKTTGTVLVGPTPANVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y K219N G190E   K20R, V35I, E36EK, K43N, I135V, T200A, A272P, K277R  
>CA16894| codons 1-278
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALIKICTELENEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVESDLEIGQHRAKIEELRQHLWRWGFYTPDNKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQ

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005