<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6832 CA17000 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NFV+ DDI+ AZT 128

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, L90M L10LF, N88D Q2QK, L5X, Q61E, L63P, V77I, I93L  
>CA17000| codons 1-99
PKITXWQRPFVTIKIGGQLKEALLDTGADNTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
EIPIEICGHKAIGTVLIGPTPVNIIGRDLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R T215TS, K219Q     K43Q, T69N, S162X, I178M, T200A, E203EK, Q207E, R211RK, A272AP, K277R  
>CA16895| codons 1-278
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEQEGKISKIGPENPYNTPV
FAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQXSMTKILEPFRKQNPDMVI
YQYMDDLYVGSDLEIGQHRAKIKELREHLLKWGFSTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQ

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001