<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 PI|RTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, I47V, I54L, I84V, L90M L33F, T74P L10I, V11L, I13V, G16A, K20R, E35D, M36I, K55N, R57K, I62V, L63P, A71V, I72V, V82I  
>HIV249b| codons 1-99
PQITLWQRPILTVKIAGQLREALLDTGADDTIFEDINLPGRWKPKMVGGIGGFLNVKQYD
QVPIEICGHKVVGPVLVGPTPINVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, M184V, L210W T215H, K219Q L100I, K103N K238T E6D, K20R, V35L, T39A, K43E, E44A, K49R, T69N, D121H, K122E, I135T, T165I, K166Q, E169D, P170L, G196E, T200TA, D218E, L228H, R284K, T286A, I293V, E297A, K311KR  
>HIV249b| codons 1-339
PISPIDTVPVKLKPGMDGPRVKQWPLTEEKIKALLEICAELEEAGKISRIGPENPYNTPV
FAIKKKNSNKWRKVVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMIQILDLFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRAKIEELRQHLWRWGFHTPEQKHQKEPPFHWMGYELHPDTWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLKGAKALTEVVPLTAEAE
LELAENREILREPVHGVYYDPSKDLIAEIQKQGQGQWTY

References
Author Title Citation
Rangel, HR Absence of primary integrase resistance mutations in HIV type 1-infected patients in Venezuela. ARHR, 2010