<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 PI|RTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82T, L90M V11I, K43T, G73S L10V, I13V, Q18R, K20I, E34EK, E35EK, M36I, N37D, I62V, L63P, I64IV, A71V, T74S, I93L, C95F  
>HIV242b| codons 1-99
PQITLWQRPVITVKIGGRLIEALLDTGADDTVLKKIDLPGRWTPKIIGGIGGFVKVRQYD
QVPVEICGHKVISSVLVGPTPTNIIGRNLMTQLGFTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L74V, M184V, L210W, T215CY   L100I, K103N   E28K, K32E, V35KR, T39A, E44D, V118I, D121Y, K122E, I135T, S162C, T200K, R211K, V245E, E248D, A272P, A288S, I293V, E297R, K311R, D324S S3A
>HIV242b| codons 1-339
PIAPIETVPVKLKPGMDGPKVKQWPLTKEKIEALREICAELEKDGKISKIGPENPYNTPV
FAIKKKNSDKWRKVVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSIPL
YEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRKKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKSLTEVVPLTREAE
LELAENREILREPVHGVYYDPSKSLIAEIQKQGQGQWTY

References
Author Title Citation
Rangel, HR Absence of primary integrase resistance mutations in HIV type 1-infected patients in Venezuela. ARHR, 2010