<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 PI|RTI NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    I72V, T112V, T124A, S230N, A239P, D256E  
>HIV261p| codons 22-288
MASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVAS
GYIEAEVIPAETGQETAYFLLKLAGRWPVKVIHTDNGSNFTSATVKAACWWAGIKQEFGI
PYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIV
DIIATDIQTKELQKQITKIQNFRVYYRDNRDPLWKGPPKLLWKGEGAVVIQDNSEIKVVP
RRKAKIIRDYGKQMAGDDCVASRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I50L, I54V, V82A, L90M Q58E L10I, L63P, A71V, V77I  
>HIV261p| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKLIGGLGGFVKVREYD
QIPIEICGHKVIGTVLIGPTPANIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y       K32R, V35T, K122E, R172RK, R211K, A272P, K281R, L283I, I293V, E297K, G333E, T338S  
>HIV261p| codons 1-339
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIRALTEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLIRGTKALTEVVPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQEQGQWSY

References
Author Title Citation
Rangel, HR Absence of primary integrase resistance mutations in HIV type 1-infected patients in Venezuela. ARHR, 2010