<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 PI|RTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I50V, I54V, I84V, L90M L10F, L33F, T74P I13V, E35EK, L63P, K70N, A71T L89R
>HIV260p| codons 1-99
PQITLWQRPFVTVKIGGQLKEALLDTGADDTVFEKMNLPGRWKPKIIGGVGGFVKVRQYD
QIPIEICGHNTIGPVLVGPTPVNVIGRNRMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215F K219E     V35T, V60I, V118I, K122E, D123DN, I135T, V179I, T200A, E203K, R211T, F214L, L228H, V245E, T286A, D324E, I326V  
>HIV260p| codons 1-339
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
YQYVDDLYVGSDLEIGQHRAKIKELRQHLLTWGLFTPDEKHQKEPPFHWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKELVAEIQKQGQGQWTY

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    A23V, S24SG, L28I, I73V, L101I, K156N, D278DN  
>HIV260p| codons 22-288
MVGDFNIPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKIVLVAVHVAS
GYIEAEVIPAETGQETAYFILKLAGRWPVKTIHTDNGSNFTSTTVKAACWWAGIKQEFGI
PYNPQSQGVVESMNNELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIV
DIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAKLLWKGEGAVVIQDNSDIKVVP
RRKAKIIRDYGKQMAGNDCVASRQDED

References
Author Title Citation
Rangel, HR Absence of primary integrase resistance mutations in HIV type 1-infected patients in Venezuela. ARHR, 2010