<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 PI|RTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54A, V82A   L10I, K20R, E35D, M36I, N37E, D60E, I62V, L63P, I64V, A71V, V77I, I93L, N98I R87RK
>HIV259p| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEDIELPGRWKPKMIGGIGGFAKVRQYE
QVPVEICGHKVIGTVLIGPTPANIIGKNLLTQLGCTLIF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V A62V     V35M, T39A, K43KE, K122E, D177E, I178L, V179I, I195IL, K201KR, E204Q, F214L, L228H, D250DN, A272P, K277R, Q278H, I293V, E297T, K311R, P313E, G333E, Q334L  
>HIV259p| codons 1-339
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICAEMEEEGKISKIGPENPYNTPV
FVIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPELII
YQYVDDLYVGSDLELGQHRTRIEQLRQHLLRWGLTTPDKKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKNSWTVNDIQKLVGKLNWASQIYPGIKVRHLCKLLRGTKALTEVVPLTTEAE
LELAENREILREEVHGVYYDPSKDLIAEIQKQELGQWTY

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
  T97TA S24N, M50MI, A91E, L101I, T112V, S119R, I220L A239AE
>HIV259p| codons 22-288
MANDFNLPPVVAKEIVASCDKCQLKGEAIHGQVDCSPGIWQLDCTHLEGKIILVAVHVAS
GYIEAEVIPEETGQEAAYFILKLAGRWPVKVIHTDNGRNFTSTTVKAACWWAGIKQEFGI
PYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIV
DIIATDIQTKELQKQITKLQNFRVYYRDSRDPLWKGPEKLLWKGEGAVVIQDNSDIKVVP
RRKAKIIRDYGKQMAGDDCVASRQDED

References
Author Title Citation
Rangel, HR Absence of primary integrase resistance mutations in HIV type 1-infected patients in Venezuela. ARHR, 2010