<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA641 CA16989 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 104
2 AZT+DDI 117
3 3TC+AZT 31
4 3TC+AZT+IDV 26
5 3TC+D4T+IDV 27
6 3TC+D4T+RTV+SQV 78
7 DDI+EFV+Unknown 24
8 D4T+IDV+RTV 87

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I54V, V82A, L90M F53L, L89V L10I, L33M, N37C, I62V, L63P, A71V, C95CS  
>CA16989| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTIMEEMCLPGRWKPKIIGGIGGLVKVRQYD
QVPIEICGHKVIGTVLVGPTPANIIGRNVMTQIGSTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L74V, L210W, T215Y   L100I, K103N   P4PS, E28EK, V35M, T39S, E44D, V118I, K122E, T200A, E203K, Q207D, H208Y, R211K, K223E, L228H  
>CA16882| codons 1-257
PISSIETVPVKLKPGMDGPKVKQWPLTKEKIKALMEICSELEKDGKISKIGPENPYNTPV
FAIKKKNSDKWRKVVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRAKIKELRDYLWKWGFYTPDKKHQEEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDI

References
Author Title Citation
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005