<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
EP-2154 EP-2154 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74I, L210W, T215Y       I63*, K64R, R83K, K104E, V118I, Q174H, I178M, G196E, Q207E, R211K, V245E  
>EP-2154| codons 41-247
LEKEGKISKIGPENPYNTPVFA*RKKNSTKWRKIVDFRELNKKTQDFWEVQLGIPHPAGL
KKKESVTVLDVGDAYFSIPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFRKHNPDMVIYQYMDDLYVGSDLEIEQHRTKIEELREHLWKWGFYTPDKK
HQKEPPFLWMGYELHPDKWTVQPIELP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, R41K, K43R, I62V, L63T, A71T, V77I, I93L  
>EP-2154| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGKWRPKMIGGIGGFIKVRQYD
QVTIEICGHKTIGTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Perez, EE Human immunodeficiency virus type 1 protease genotype predicts immune and viral responses to combination therapy with protease inhibitors (PIs) in PI-naive patients. J Infect Dis, 2001