<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
EP-2000 EP-2000 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L210W, T215Y A62V     I63*, K64R, T69S, D121Y, K122E, A158S, S162D, F171L, K173N, Q174K, I178L, Q207E, R211K R172E
>EP-2000| codons 41-247
MEKEGKISKIGPENPYNTPVFV*RKKDSSKWRKLVDFRELNKRTQDFWEVQLGIPHPAGL
KKKKSVTVLDVGDAYFSVPLYEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIF
QDSMTKILEPLENKNPDLVIYQYMDDLYVGSDLEIGQHRTKIEELREHLWKWGFYTPDKK
HQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    P39T, R41K, D60E, L63P, I64V, V82I  
>EP-2000| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLTGKWKPKMIGGIGGFIKVRQYE
QIPVEICGHKAIGTVLVGPTPINIIGRNLLTQIGCTLNF

References
Author Title Citation
Perez, EE Human immunodeficiency virus type 1 protease genotype predicts immune and viral responses to combination therapy with protease inhibitors (PIs) in PI-naive patients. J Infect Dis, 2001