<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L210W, T215Y A62V     I63*, K64R, T69S, D121Y, K122E, A158S, S162D, F171L, K173N, Q174K, I178L, Q207E, R211K R172E
>EP-2000| codons 41-247
MEKEGKISKIGPENPYNTPVFV*RKKDSSKWRKLVDFRELNKRTQDFWEVQLGIPHPAGL
KKKKSVTVLDVGDAYFSVPLYEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIF
QDSMTKILEPLENKNPDLVIYQYMDDLYVGSDLEIGQHRTKIEELREHLWKWGFYTPDKK
HQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    P39T, R41K, D60E, L63P, I64V, V82I  
>EP-2000| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLTGKWKPKMIGGIGGFIKVRQYE
QIPVEICGHKAIGTVLVGPTPINIIGRNLLTQIGCTLNF

References
Author Title Citation
Perez, EE Human immunodeficiency virus type 1 protease genotype predicts immune and viral responses to combination therapy with protease inhibitors (PIs) in PI-naive patients. J Infect Dis, 2001