<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K20I, M36I, P39L, R41K, I62IV, L63P, I64M, H69K, V82I, L89M  
>08GQ463| codons 1-99
PQITLWQRPLVTVKIGGQLIEALLDTGADDTVLEEINLLGKWKPKMIGGIGGFIKVRQYD
QVPMEICGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36D, T39L, K64KR, K122E, D123G, I135V, S162A, K173IT, Q174K, D177E, T200A, Q207E, R211K, P243L, V245Q, K277T, T286A, E291D, V292I, I293V, P294A, S322A, I326V, G335D, R356K, M357K, G359S, A371V, I375V, T377R, K390R, T403M  
>08GQ463| codons 1-432
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTDICLEMEKEGKISKIGPENPYNTPV
FAIRKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQLIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVTQLCKLLRGAKALTDIVALTEEAE
LELAENREILKEPVHGVYYDPAKDLVAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKKRSA
HTNDVKQLTEVVQKVARESIVIWGKTPKFRLPIQKETWEAWWMEYWQATWIPEWEFVNTP
PLVKLWYQLEKE

References
Author Title Citation
Djoko, CF HIV type 1 pol gene diversity and genotypic antiretroviral drug resistance mutations in Malabo, Equatorial Guinea. ARHR, 2010