<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, E35D, M36I, R41K, L63V, H69K, V77VI, L89M  
>08GQ281| codons 1-99
PQITLWQRPVVTVKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLIGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        P4S, K11S, V35T, T39R, D123S, K173S, Q174K, D177E, G196E, Q197K, Q207A, R211S, F214L, V245Q, E248D, K275Q, I293V, P294Q, K311R, E312N, I326V, G335D, M357K, G359S, K366R, T369A, I375V, T377L, V381I, A400T, T403M, E404D  
>08GQ281| codons 1-431
PISSIETVPVSLKPGMDGPKVKQWPLTEEKIKALTEICREMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKSFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSKNPEIVI
YQYMDDLYVGSDLEIEKHRTKIEELRAHLLSWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYAGIQVKQLCKLLRGTKALTEVVQLTEEAE
LELAENREILRNPVHGVYYDPSKDLVAEIQKQGQDQWTYQIYQEPFKNLKTGKYARKRSA
HTNDVRQLAEAVQKVALESIIIWGKTPKFKLPIQKETWETWWMDYWQATWIPEWEFVNTP
PLVKLWYQLEK

References
Author Title Citation
Djoko, CF HIV type 1 pol gene diversity and genotypic antiretroviral drug resistance mutations in Malabo, Equatorial Guinea. ARHR, 2010