<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, G17E, E35D, M36L, R57RK, L63T, C67F, H69K, I72IV, L89M  
>CD4078| codons 1-99
PQITLWQRPIVTVKIGEQLKEALLDTGADDTVLEDLNLPGRWKPKMIGGIGGFIKVKQYD
QITIEIFGKKAVGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K11KNRS, V35T, T39TK, V60I, K122E, D123G, I135V, K173T, T200EG, Q207A, R211S, F214L, V245E, A272P, K281R, T286A, E291D, I293V, P294T, D324E, G335E, R356K, M357R, R358G, G359T  
>CD4078| codons 1-369
PISPIETVPVSLKPGMDGPKVKQWPLTEEKIKALTEICKEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTQNPDIVI
YQYMDDLYVGSDLEIGQHRGKIEELRAHLLSWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLLRGAKALTDVVTLTEEAE
LELAENREILKEPVHGVYYDPSKELIAEIQKQGQEQWTYQIYQEPFKNLKTGKYAKRGTA
HTNDVKQLT

References
Author Title Citation
Djoko, CF High HIV type 1 group M pol diversity and low rate of antiretroviral resistance mutations among the uniformed services in Kinshasa, DRC. ARHR, 2010