<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
682 CD4059 DRC 2007 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, L33V, R41K, L63P, H69Q  
>CD4059| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVVEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGQKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E40D, K49R, I50V, V60I, K64R, T69S, K122E, D123G, I142V, K173T, Q174K, D177E, G196E, T200A, Q207E, V245H, A272P, K275R, K277R, T286A, E291D, V292VI, I293V, E312S, K323KR, I329V, Q334L, G335D, M357R, R358K, T369A R78RK, V111VG
>CD4059| codons 1-371
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTDMEKEGKISRVGPENPYNTPI
FAIRKKDSSKWRKLVDFKELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDGGDAYFSVPL
DEGFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPEIVI
YQYMDDLYVGSDLEIEQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIHLPEKDSWTVNDIQKLVGKLNWASQIYPGIRVRQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKSPVHGVYYDPSRDLIAEVQKQGLDQWTYQIYQEPFKNLKTGKYARRKGA
HTNDVKQLAEA

References
Author Title Citation
Djoko, CF High HIV type 1 group M pol diversity and low rate of antiretroviral resistance mutations among the uniformed services in Kinshasa, DRC. ARHR, 2010