<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6888 CA16967 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 202

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215F N348I     I31V, A98S, D123E, S162C, E169ED, T200A, A288S, D324E, M357V, A376T, A400T, T403R, V435A, V466A, S468P, Q480H, K512T, S519N, A554NSTY, I556V N265NY
>CA16967| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKVKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELRQHLLRWGFFTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLYWASQIYAGIKVKQLCKLLRGTKSLTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKELIAEIQKQGQGQWTYQIYQEPFKILKTGKYARVRGA
HTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWREYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIAGAETFYVDGAANRETKLGKAGYVTDRGRQKAVPLTDTTNQKTELH
AIHLALQDSGLEVNIVTDSQYALGIIQAQPDTSESELVNQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSYGVRKVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, G16E, I62V, L63A, I72V  
>CA17075| codons 1-99
PQITLWQRPLVTIKVEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QVAIEICGHKAVGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009