<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1860 CA16956 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 209
2 3TC+AZT+IDV 58
3 D4T+DDI+RTV+SQV 36
4 3TC+D4T+DDI+EFV 90

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, L74IV, M184I, T215F K219Q G190E A98G K20R, V35E, T39A, V60I, K101R, K103R, V118I, K122E, I135K, F214L, L228H, I293V, E297K, T386I, K390R, A400T, V435A, A437V, V466I, V467I, Q509Y, K527NS, A554T A360AP
>CA16956| codons 1-560
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALEEICAELEKEGKISKIGPENPYNTPI
FAIKKKNSDRWRKIVDFRELNKRTQDFWEVQLGIPHPGGLRKRKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSKNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYIDDLYVESDLEIGQHRTKIEELRQHLLRWGLFTPDQKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGP
HTNDVKQLTEAVQKIATESIVIWGKIPKFRLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIAGVETFYVDGAANRETKLGKAGYVTDRGRQKIISLTDTTNQKTELQ
AIHLALQDSGLEVNIVTDSQYALGIIQAYPDKSESELVSQIIEQLISKEKVYLAWVPAHK
GIGGNEQVDKLVSTGIRKVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, L90M   L10I, I13V, K14R, R41K, K55R, L63P, A71V  
>CA17064| codons 1-99
PQITLWQRPIVTVRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKLIGGIGGFVRVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005