<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6879 CA16952 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T 169
2 ABC+DDI+EFV 54

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, T215Y   K103N, G190A V108VI V35E, T39A, D123E, I135T, I142V, K166R, D177E, R211K, A272P, K277R, E291ED, V292VI, I293V, E297A  
>CA16952| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALEEICAELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPEIVI
YQYVDDLYVASDLEIGQHRTKIEELRQHLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTDIVPLTAEAE
LEL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, N37E, R57K, L63LP, I64V  
>CA17060| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDMELPGRWKPKMIGGIGGFIKVKQYD
QIPVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009