<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1825 CA16946 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 56
2 AZT+DDI 117
3 AZT+DDI+IDV 9
4 3TC+D4T+NFV 73
5 3TC+APV+D4T+NFV 71

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y       K43Q, S68G, V118I, K122KE, I135IV, Q174R, T200A, Q207E, R211RK, E224ED, A272P, E291D, D324E, G333E, Q334H, T338S, K390R, A400T, T403TM, D460N, V466VI, V467VI, T470TP, L491LS, S519N, Q524QE, E529D, K530R, I556V, K558R  
>CA16946| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEQEGKISKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKRNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLWKWGFYTPDKKHQKDPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTDVIPLTEEAE
LELAENREILKEPVHGVYYDPSKELIAEIQKQEHGQWSYQIYQEPFKNLKTGKYARMRGA
HTNDVKQLTEAVQKIATESIVIWGKTPKFRLPIQKETWETWWMEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKIISLPDTTNQKTELQ
AIHLALQDSGSEVNIVTDSQYALGIIQAQPDKSESELVNQIIEELIKKDRVYLAWVPAHK
GIGGNEQVDKLVSAGVRRVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, L90M L33F, Q58E, G73A L10I, L19X, I54X, L63P, H69HY, A71T, I72T, V77I, I93L  
>CA17054| codons 1-99
PQITLWQRPIVTIKIGGQXKEALLDTGADDTVFEEMNLPGRWKPKLIGGIGGFXKVREYD
QIPIEICGYKTTATVLIGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005