<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6868 CA16939 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 48
2 3TC+AZT+IDV 87
3 3TC+D4T+RTV 39
4 D4T+DDC+NFV 48
5 DDI+ 3TC+ EFV 5

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L210W, T215FY K219E     K20R, V35L, T39A, E53D, V118I, K122E, E138A, S162C, F171Y, G196E, T200A, R211K, E248Q, A272P, L283I, R284K, I293V, E297K K281KE, A299AG
>CA16939| codons 1-303
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALLEICAELEKEGKISKIGPDNPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNATPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPYRKQNPDIVI
YQYMDDLYVGSDLEIEQHRAKIEELRQHLWKWGFFTPDEKHQKEPPFLWMGYELHPDKWT
VQPIVLPQKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCELIKGTKALTEVVPLTKEGE
LEL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82A, L90M K43T L10I, I15V, L19V, E34Q, M36I, G51A, I62V, L63P, A71V, Q92R  
>CA17045| codons 1-99
PQITLWQRPIVTIKVGGQVKEALLDTGADDTVLQEINLPGRWTPKMIGGIAGFIKVRQYD
QVPIEICGHKVIGTVLVGPTPANIIGRNLMTRIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005