<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
VL08_104 VL08_104 India 2008 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 PI|RTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, L19T, M36V, R41K, D60E, Q61E, L63P, H69K, L89M, I93L  
>VL08_104| codons 1-99
PQITLWQRPLVTIKVGGQTKEALLDTGADDTVLEEVNLPGKWKPKMIGGIGGFIKVRQYE
EIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Kandathil, AJ A comparison of interpretation by three different HIV type 1 genotypic drug resistance algorithms using sequences from non-clade B HIV type 1 strains. ARHR, 2009