<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
VL08_104 VL08_104 India 2008 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 PI|RTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, L19T, M36V, R41K, D60E, Q61E, L63P, H69K, L89M, I93L  
>VL08_104| codons 1-99
PQITLWQRPLVTIKVGGQTKEALLDTGADDTVLEEVNLPGKWKPKMIGGIGGFIKVRQYE
EIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103N   V35T, E36A, T39D, S48T, V60I, D121Y, K122E, I135KMRT, E138A, S162A, K166KIRT, K173A, T200A, Q207E, R211K, V245Q, A272P, K277R, T286A, E291D, V292I, I293V D177INST, Y183Y*
>VL08_104| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICDEMEKEGKITKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSTNNATPGIRYQYNVLPQGWKGSPAIFQASMTTILEPFRAQNPTIVI
YQ*VDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVPLTEEAE

References
Author Title Citation
Kandathil, AJ A comparison of interpretation by three different HIV type 1 genotypic drug resistance algorithms using sequences from non-clade B HIV type 1 strains. ARHR, 2009