<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 PI|RTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, M36I, R41K, L63P, H69K, L89M, I93L  
>VL07_048| codons 1-99
PQITLWQRPLVSIKVGGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Y115F, Q151M, M184V V75I, F77L, F116Y Y188L   V35T, T39N, S48T, V60I, K65X, S68G, K70X, V106I, D121Y, K122E, I135V, S162A, K173A, D177E, I178V, G196E, T200A, Q207E, V245E, A272P, K277R, E291D, V292I, I293V Y232H
>VL07_048| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICNEMEKEGKITKIGPENPYNTPI
FAIKTKDGTTWRKLIDLRELNKRTQDFWEVQLGIPHPAGLKKKKSITVLDVGDAFYSVPL
YEDFRKYTAFTIPSVNNETPGIRYQYNVLPMGWKGSPAIFQASMTKILEPFRAQNPEVVI
YQYVDDLLVGSDLEIEQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGHELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTDIVPLTEEAE

References
Author Title Citation
Kandathil, AJ A comparison of interpretation by three different HIV type 1 genotypic drug resistance algorithms using sequences from non-clade B HIV type 1 strains. ARHR, 2009