<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
VL06_192 VL06_192 India 2007 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 PI|RTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, E35D, M36I, N37E, L63T, H69K, T74S, L76X, L89M, I93L  
>VL06_192| codons 1-99
PQITLWQRPLVSIKVGGQIKEALLDTGADDTVLEDIELPGRWKPKMIGGIGGFIKVRQYD
QITIEICGKKAIGSVVVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Kandathil, AJ A comparison of interpretation by three different HIV type 1 genotypic drug resistance algorithms using sequences from non-clade B HIV type 1 strains. ARHR, 2009