<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
VL06_192 VL06_192 India 2007 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 PI|RTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L76LIV   T12S, I15V, L19I, E35D, M36I, N37E, L63T, H69K, T74S, L89M, I93L  
>VL06_192| codons 1-99
PQITLWQRPLVSIKVGGQIKEALLDTGADDTVLEDIELPGRWKPKMIGGIGGFIKVRQYD
QITIEICGKKAIGSVVVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70KMRT, M184V, T215F   K103N, M230L V108I V35T, T39E, S48T, V60I, D121Y, K122E, I135T, S162A, K173T, D177E, T200A, E203D, Q207N, L210LF, R211K, H221Y, V245Q, A272P, K277R, K281R, E291D, V292I, I293V, E297A K238K*EQ
>VL06_192| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEEMEKEGKITKIGPENPYNTPI
FAIKKKDSTTWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
YEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTQNPEIVI
YQYVDDLYVGSDLEIGQHRAKIDELRNHLFKWGFFTPDKKYQKEPPFLWLGYELHPDQWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCRLLRGTKALTDIVPLTAEAE

References
Author Title Citation
Kandathil, AJ A comparison of interpretation by three different HIV type 1 genotypic drug resistance algorithms using sequences from non-clade B HIV type 1 strains. ARHR, 2009