<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 PI|RTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M K43T T12S, I15V, L19I, K20T, E35D, M36I, R41K, L63P, H69K, T74S, I93L  
>VL07_040| codons 1-99
PQITLWQRPLVSIKVGGQITEALLDTGADDTVLEDINLPGKWTPKIIGGIGGFIKVRQYD
QIPIEICGKKAIGSVLVGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, V75M, M184V, T215F K219Q K103S, G190A   I31L, V35T, T39N, S48T, V60I, D121Y, K122E, T139K, I142V, S162A, K173A, Q174K, D177E, Q197H, T200A, Q207E, H208Y, R211K, L228H, V245K, A272P, E291D, V292I, I293V  
>VL07_040| codons 1-307
PISPIETVPVKLKPGMDGPKVKQWPLTEEKLKALTEICNELEKEGKITKIGPENPYNTPI
FAIKKKNSDRWRKLMDFRELNKRTQDFWEVQLGIPHPAGLKKSKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSINNEKPGVRYQYNVLPQGWKGSPAIFQASMTKILEPFRAKNPEIVI
YQYVDDLYVASDLEIGHHRAKIEELREYLLKWGFFTPDQKHQKEPPFHWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTDIVPLTEEAE
LELAENR

References
Author Title Citation
Kandathil, AJ A comparison of interpretation by three different HIV type 1 genotypic drug resistance algorithms using sequences from non-clade B HIV type 1 strains. ARHR, 2009