<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 PI|RTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88D, L89V L10M, T12S, I13V, I15V, L19T, K20T, E21D, E35K, M36I, P39A, R41K, K45R, Q61D, L63P, H69K, T74S, V82I, I93L  
>VL06_253| codons 1-99
PQITLWQRPMVSVKVGGQTTDALLDTGADNTVLEKINLAGKWKPRMIGGIGGFIKVRQYD
DIPIEICGKKAIGSVLVGPTPINIIGRDVLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215F K219E Y181C, G190A K101H V35T, T39D, N57X, V60I, V118I, D121Y, K122E, I135T, S162A, K166R, K173A, D177E, T200A, Q207E, R211K, D218E, L228H, V245Q, A272P, V292I, I293V K73N
>VL06_253| codons 1-307
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICDEMEKEGKISKIGPENPYKTPI
FAIKKKNSTRWRNLVDFRELNKRTQDFWEVQLGIPHPAGLHKKKSVTVLDVGDAYFSIPL
YEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQASMTRILEPFRAQNPEIVI
CQYVDDLYVASDLEIGQHRAKIEELREHLLKWGFFTPEEKHQKEPPFHWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEIVPLTEEAE
LELAENR

References
Author Title Citation
Kandathil, AJ A comparison of interpretation by three different HIV type 1 genotypic drug resistance algorithms using sequences from non-clade B HIV type 1 strains. ARHR, 2009