<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    S17N, L101I, T112I, T124S, T125A, K136Q, V201I, A205S, K211R, T218I, L234V, D256E S283G
>LVMP411| codons 1-288
FLDGIDKAQEEHEKYHNNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKIIHTDNGSN
FTSSAVKAACWWAGIQQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIISTDIQTRELQKQIIKIQNFRVYYRDSRDPVWKGPAK
LLWKGEGAVVIQDNSEIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I   L5F, K14R, I15V, K20R, E35D, M36I, N37D, R41K, R57K, L63T, E65D, L89M  
>LVMP411| codons 1-99
PQITFWQRPLVTIRVGGQLREALLDTGADDTVLEDIDLPGKWKPKIIGGIGGFIKVKQYD
QITIDICGHKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E40D, V60I, D123E, I135L, K173A, Q174K, I195L, T200M, Q207E, R211K, V245Q, A272P, V276I, T286A, E291D, V292I, I293V, I329L, R356K, M357T, G359S, V365I, Q367E, E370D, I375V, T377R, S379C, T386S, K390R, E404D, K431T, V435I, A446S, L452K, V466A, S468I, D471E, T477A, L491S, A502V, L517I, S519N, Q520K, Q524K, K527Q, K530R, A534S, K550R, V559I  
>LVMP411| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTDMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPDIVI
YQYMDDLYVGSDLELGQHRMKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKIKQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAELQKQGQGQWTYQIYQEPFKNLKTGKYAKTRSA
HTNDIKELTDAVQKVARECIVIWGKSPKFRLPIQKETWEAWWTDYWQATWIPEWEFVNTP
PLVKLWYQLETEPIIGAETFYVDGASNRETKKGKAGYVTDRGRQKAVILTETTNQKAELQ
AIHLALQDSGSEVNIVTDSQYVLGIIQAQPDKSESEIVNKIIEKLIQKERVYLSWVPAHK
GIGGNEQVDRLVSAGIRKIL

References
Author Title Citation
Triques, K Near full length genome sequencing of divergent African HIV type 1 subtype F viruses leads to identification of a new HIV type 1 designated K. ARHR, 2000