<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
97CA-MP645 MP97CA Cameroon 1997 HIV1 CRF02_AG PBMC None

Treatment History
Order Regimen Weeks
1 Unknown NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
T66A L74M K14R, V31I, I72V, I84V, L101I, T112I, T125A, G134N, I135V, K136T, V201I, T206S, L234I, R269K V281A, D286N
>MP97CA| codons 1-288
FLDGIDKAQEEHERYHSNWRAMASDFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCAHLEGKVIMVAVHVASGYVEAEVIPAETGQETAYFILKLAGRWPVKIIHTDNGSN
FTSTAVKAACWWANVTQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIASDIQTKELQKQITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIKDYGKQMAGDDCAASRQNED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L5F, I13V, K14R, K20I, M36I, R41K, H69K, L89M  
>MP97CA| codons 1-99
PQITFWQRPLVTVRIGGQLIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Peeters, M Characterization of a highly replicative intergroup M/O human immunodeficiency virus type 1 recombinant isolated from a Cameroonian patient. J Virol, 1999