<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4334 CA16860 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 26
2 3TC+D4T+IDV 52
3 DDI+DLV+RTV+SQV 52
4 D4T+ADV+EFV+RTV+SQV 21
5 None 26
6 ABC+D4T+APV+NFV 26
7 3TC+ABC+D4T+APV 26

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67DN, L74LV, M184MV, L210W, T215DY K219N M230ML V179VD T39E, R83K, K103R, V118VI, K122KE, S162C, K173KR, I178IM, G196GE, E203D, H208HY, R211K, V245Q, T286A, V292I  
>CA16860| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICEELEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKVVDFRELNKKTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRRQNPDMDI
YQYVDDLYVGSDLEIEQHRTKIDELRQYLWKWGFDTPDNKHQKEPPFLWLGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEIIPLTEEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54IV, I84IV, L90LM L33LI L10LI, L19LI, K20X, E35D, M36MI, N37D, L63P, A71IT, Q92QK  
>CA17100| codons 1-99
PQITLWQRPIVTIKIGGQIXEALLDTGADDTVIEDIDLPGRWKPKMIGGIGGFVKVRQYD
QIPIEICGHKIIGTVLVGPTPVNVIGRNLMTKIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005