<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33F I13V, K20V, M36I, N37S, R41K, H69K, K70R, L89M  
>RB4021| codons 4-99
TLWQRPLVTVKIGGQLVEALLDTGADDTVFEEISLPGKWKPKMIGGIGGFIKVRQYDQIL
IEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103KN   K122E, I135V, S162A, K173T, Q174R, D177E, I178M, T200A, Q207E, R211K, F214L, V245Q Q145Q*
>RB4021| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSVNNETPGIRY*YNVLPQGWKGSP
AIFQASMTKILEPFRTRNPEMVIYQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGLTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIQLP

References
Author Title Citation
Parker, MM Prevalence of drug-resistant and nonsubtype B HIV strains in antiretroviral-naive, HIV-infected individuals in New York State. AIDS Patient Care STDS, 2007