<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA478 CA16853 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None 52
2 AZT+DDI 386
3 3TC+D4T+NVP 104

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, K70R, Q151M, M184V V75I, F77L, F116Y K103N   V35M, T39A, S68G, E79D, R83K, V90I, A158S, I202IV, R211K, D218E, V245E, R284K, T286A, E297A K281KE
>CA16853| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICAEMEKEGKISKIGPENPYNTPV
FAIKRKDGTRWRKLIDLRDLNKKTQDFWEIQLGIPHPAGLKKNKSVTVLDVGDAYYSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPSIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKVEELRQHLLKWGFTTPEKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCELLKGAKALTEVIPLTAEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005