<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AH-HC12 HolgHC12 Equatorial Guinea 1998 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13A, K14R, K20I, E35A, M36I, R41K, L63P, H69K, L89M, N98I  
>HolgHC12| codons 9-99
PLVTARIGGQLIEALLDTGADDTVLEAINLPGKWKPKMIGGIGGFIKVRQYDQIPIEICG
KKAIGTVLVGPTPVNIIGRNMLTQIGCTLIF

References
Author Title Citation
Holguin, A Protease gene analysis of HIV Type 1 non-B subtypes in Spain. ARHR, 2000
Holguin, A Heterogeneous nature of HIV-1 recombinants spreading in Spain. J Med Virol, 2005
Holguin, A Impact of frequent natural polymorphisms at the protease gene on the in vitro susceptibility to protease inhibitors in HIV-1 non-B subtypes. J Clin Virol, 2004