Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| AH-HC12 | HolgHC12 | Equatorial Guinea | 1998 | HIV1 | CRF02_AG | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | None | NA |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| I13A, K14R, K20I, E35A, M36I, R41K, L63P, H69K, L89M, N98I |
| >HolgHC12| codons 9-99 PLVTARIGGQLIEALLDTGADDTVLEAINLPGKWKPKMIGGIGGFIKVRQYDQIPIEICG KKAIGTVLVGPTPVNIIGRNMLTQIGCTLIF |
References
| Author | Title | Citation |
| Holguin, A | Protease gene analysis of HIV Type 1 non-B subtypes in Spain. | ARHR, 2000 |
| Holguin, A | Heterogeneous nature of HIV-1 recombinants spreading in Spain. | J Med Virol, 2005 |
| Holguin, A | Impact of frequent natural polymorphisms at the protease gene on the in vitro susceptibility to protease inhibitors in HIV-1 non-B subtypes. | J Clin Virol, 2004 |